PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_23884A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 115aa    MW: 13150.3 Da    PI: 10.2982
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_23884AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK67.91.5e-211371652
                     RWP-RK 16 lpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                               +pi++AA e++v+lTvLK++CR++G++RWPhRk+ksl
  Oropetium_20150105_23884A  1 MPITQAAHEMNVGLTVLKKRCRELGVARWPHRKMKSL 37
                               79*********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF020421.3E-16137IPR003035RWP-RK domain
PROSITE profilePS5151915.289158IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MPITQAAHEM NVGLTVLKKR CRELGVARWP HRKMKSLRSL ILNVQEMGKG LAPAAVQREL  60
EAYCALMEED PSIELTDRTK KLRQACFKEN YKRRRAATVR NVVDHVYNDF SHVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971918.19e-58PREDICTED: uncharacterized protein LOC101757335
SwissprotQ9LVU88e-34RKD4_ARATH; Protein RKD4
TrEMBLF5CJE39e-59F5CJE3_WHEAT; RWP-RK domain containing protein
TrEMBLR7W9U06e-59R7W9U0_AEGTA; Uncharacterized protein
STRINGGRMZM2G071322_P012e-51(Zea mays)
STRINGSb03g025130.12e-51(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP128882330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.14e-35RWP-RK domain-containing protein